Alpha A Crystallin Antibody — image 1 of 2

Product details

Alpha A Crystallin Antibody

Catalog number KC-7870-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7870-01

Size / count 50 μL

Specifications

Catalog number: KC-7870-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Alpha-crystallin A chain, Heat shock protein beta-4, HspB4) [Cleaved into: Alpha-crystallin A (1-172, Alpha-crystallin A (1-168, Alpha-crystallin A (1-162]
Gene Name: CRYAA
Gene ID: 1409
UniProt: P02489
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CRYAA
Target: PP-10652
Partner Proteins: Alpha-crystallin A chain; Heat shock protein beta-4; HspB4) [Cleaved into: Alpha-crystallin A (1-172; Alpha-crystallin A (1-168; Alpha-crystallin A (1-162]
Clone: K8U013_2A6
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 92%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CRYA1; HSPB4
Target Alternative Name: Alpha A Crystallin
Host or Source: Mouse
Protein Name: Crystallin alpha A
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Alpha A Crystallin Antibody?

The catalog number for Alpha A Crystallin Antibody is KC-7870.

What sizes are available for Alpha A Crystallin Antibody?

Alpha A Crystallin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha A Crystallin Antibody come in?

Alpha A Crystallin Antibody is available in 3 different pack sizes.

Is Alpha A Crystallin Antibody in stock?

Alpha A Crystallin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

All Products