Prolactin Antibody

Catalog number KC-3550-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-3550-01

Size / count 50 μL

Specifications

Catalog number: KC-3550-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Prolactin, PRL
Gene Name: PRL
Gene ID: 5617
UniProt: P01236
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRL
Target: PP-059
Partner Proteins: Prolactin; PRL
Clone: K52025_2G12
Conjugation: Unconjugated
Applications: ELISA
Validation: ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 60%, Rat - 62%, Pig - 77%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: LATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 60%
Recombinant Antibody: Not recombinant
Sandwich ELISA Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Prolactin
Panel Description: IHC Pathology
Host or Source: Mouse
Protein Name: Prolactin
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Prolactin Antibody?

The catalog number for Prolactin Antibody is KC-3550.

What sizes are available for Prolactin Antibody?

Prolactin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Prolactin Antibody come in?

Prolactin Antibody is available in 3 different pack sizes.

Is Prolactin Antibody in stock?

Prolactin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.