Adenosine Deaminase Antibody

Catalog number KC-7481-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7481-01

Size / count 50 μL

Specifications

Catalog number: KC-7481-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Adenosine deaminase, Adenosine aminohydrolase
Gene Name: ADA
Gene ID: 100
UniProt: P00813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADA
Target: PP-1636
Partner Proteins: Adenosine deaminase; Adenosine aminohydrolase
Clone: K40075_1F10
Conjugation: Unconjugated
Applications: Top_IP/ChIP&ELISA
Validation: Top_IP/ChIP&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ADA1
Target Alternative Name: Adenosine Deaminase
Host or Source: Mouse
Protein Name: Adenosine deaminase
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Adenosine Deaminase Antibody?

The catalog number for Adenosine Deaminase Antibody is KC-7481.

What sizes are available for Adenosine Deaminase Antibody?

Adenosine Deaminase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Adenosine Deaminase Antibody come in?

Adenosine Deaminase Antibody is available in 3 different pack sizes.

Is Adenosine Deaminase Antibody in stock?

Adenosine Deaminase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

All Products