Adenosine Deaminase Antibody

Catalog number KC-7483-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-7483-01

Size / count 50 μL

Specifications

Catalog number: KC-7483-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Adenosine deaminase, Adenosine aminohydrolase
Gene Name: ADA
Gene ID: 100
UniProt: P00813
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ADA
Target: PP-1636
Partner Proteins: Adenosine deaminase; Adenosine aminohydrolase
Clone: K40075_2E1
Conjugation: Unconjugated
Applications: Top_IP/ChIP
Validation: Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 87%
Recombinant Antibody: Not recombinant
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ADA1
Target Alternative Name: Adenosine Deaminase
Host or Source: Mouse
Protein Name: Adenosine deaminase
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Adenosine Deaminase Antibody?

The catalog number for Adenosine Deaminase Antibody is KC-7483.

What sizes are available for Adenosine Deaminase Antibody?

Adenosine Deaminase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Adenosine Deaminase Antibody come in?

Adenosine Deaminase Antibody is available in 3 different pack sizes.

Is Adenosine Deaminase Antibody in stock?

Adenosine Deaminase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

All Products