Recombinant ZBTB49 Antibody

Catalog number RN-13501-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-13501-01

Size / count 50 μL

Specifications

Catalog number: RN-13501-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Zinc finger and BTB domain-containing protein 49, Zinc finger protein 509
Gene Name: ZBTB49
Gene ID: 166793
UniProt: Q6ZSB9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ZBTB49
Target: PP-9502
Partner Proteins: Zinc finger and BTB domain-containing protein 49; Zinc finger protein 509
Clone: K29068_11C2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 57%, Pig - 64%, Cynomolgus monkey - 95%
Purity: ≥85%
Cores: PSQERVVEQPFAFSTSTDLTTVESQPCAVSHSECILESPEHLPSNFLAQPVNDSAPHPESDATCQQPVKQMRLKKAIHLKKLNFLKSQKYAEQVSEPKSDDGLTKRLESASKNTLEKASSQSAEEKESEEVVSCENFNCISETERPEDPAALEDQSQTLQSQRQYACELCGKPFKHPSNL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 57%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ZNF509
Target Alternative Name: ZBTB49
Panel Description: Transcription Factors, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Zinc finger and BTB domain containing 49
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ZBTB49 Antibody?

The catalog number for Recombinant ZBTB49 Antibody is RN-13501.

What sizes are available for Recombinant ZBTB49 Antibody?

Recombinant ZBTB49 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ZBTB49 Antibody come in?

Recombinant ZBTB49 Antibody is available in 3 different pack sizes.

Is Recombinant ZBTB49 Antibody in stock?

Recombinant ZBTB49 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.