Product details

CaMKII alpha Antibody

Catalog number KC-34373-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-34373-01

Size / count 50 μL

Specifications

Catalog number: KC-34373-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calcium/calmodulin-dependent protein kinase type II subunit alpha, CaM kinase II subunit alpha, CaMK-II subunit alpha
Gene Name: CAMK2A
Gene ID: 815
UniProt: Q9UQM7
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human CAMK2A
Target: P66790PB
Partner Proteins: Calcium/calmodulin-dependent protein kinase type II subunit alpha; CaM kinase II subunit alpha; CaMK-II subunit alpha
Clone: K29108_11A11
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: KKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CAMKA; KIAA0968
Target Alternative Name: CaMKII alpha
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Calcium/calmodulin dependent protein kinase II alpha
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CaMKII alpha Antibody?

The catalog number for CaMKII alpha Antibody is KC-34373.

What sizes are available for CaMKII alpha Antibody?

CaMKII alpha Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CaMKII alpha Antibody come in?

CaMKII alpha Antibody is available in 3 different pack sizes.

Is CaMKII alpha Antibody in stock?

CaMKII alpha Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

All Products