Recombinant SMPX Antibody

Catalog number RN-14585-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14585-01

Size / count 50 μL

Specifications

Catalog number: RN-14585-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Small muscular protein, Stretch-responsive skeletal muscle protein
Gene Name: SMPX
Gene ID: 23676
UniProt: Q9UHP9
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SMPX
Target: PP-5948
Partner Proteins: Small muscular protein; Stretch-responsive skeletal muscle protein
Clone: K8U055_1D11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Rat - 81%, Pig - 93%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: VRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSEL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Yes
IHC Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SRMX
Target Alternative Name: SMPX
Host or Source: Mouse
Protein Name: Small muscle protein X-linked
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant SMPX Antibody?

The catalog number for Recombinant SMPX Antibody is RN-14585.

What sizes are available for Recombinant SMPX Antibody?

Recombinant SMPX Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SMPX Antibody come in?

Recombinant SMPX Antibody is available in 3 different pack sizes.

Is Recombinant SMPX Antibody in stock?

Recombinant SMPX Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.

Is this product tested for endotoxin levels?

Endotoxin testing status is noted on the datasheet where applicable, particularly for recombinant proteins intended for cell-based or functional assays. If this isn’t listed and you need confirmation, contact support with the catalogue number.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.