Recombinant ADAM22 Antibody

Catalog number RN-14443-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14443-01

Size / count 50 μL

Specifications

Catalog number: RN-14443-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Disintegrin and metalloproteinase domain-containing protein 22, ADAM 22, Metalloproteinase-disintegrin ADAM22-3, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
Gene Name: ADAM22
Gene ID: 53616
UniProt: Q9P0K1
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: Recombinant human ADAM22
Target: PP-1373
Partner Proteins: Disintegrin and metalloproteinase domain-containing protein 22; ADAM 22; Metalloproteinase-disintegrin ADAM22-3; Metalloproteinase-like; disintegrin-like; and cysteine-rich protein 2
Clone: K40080_19B1
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Pig - 99%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: QGDYVKKPGDGDSFYSDIPPGVSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNLGGNKKKIRGKRFRPRSNSTETLSPAKSPSSSTGSIASSRKYPYPMPPLPDE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MDC2
Target Alternative Name: ADAM22
Host or Source: Mouse
Protein Name: ADAM metallopeptidase domain 22
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ADAM22 Antibody?

The catalog number for Recombinant ADAM22 Antibody is RN-14443.

What sizes are available for Recombinant ADAM22 Antibody?

Recombinant ADAM22 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ADAM22 Antibody come in?

Recombinant ADAM22 Antibody is available in 3 different pack sizes.

Is Recombinant ADAM22 Antibody in stock?

Recombinant ADAM22 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products