Recombinant MRAP Antibody

Catalog number RN-14662-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14662-01

Size / count 50 μL

Specifications

Catalog number: RN-14662-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Melanocortin-2 receptor accessory protein, B27, Fat cell-specific low molecular weight protein, Fat tissue-specific low MW protein
Gene Name: MRAP
Gene ID: 56246
UniProt: Q8TCY5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MRAP
Target: PP-5247
Partner Proteins: Melanocortin-2 receptor accessory protein; B27; Fat cell-specific low molecular weight protein; Fat tissue-specific low MW protein
Clone: K29113_3A7
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Cynomolgus monkey - 90%
Purity: ≥85%
Cores: SHGLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPDQPLRQESSSTLPLGGFQTHPTLLWELTLNG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C21orf61; FALP
Target Alternative Name: MRAP
Host or Source: Mouse
Protein Name: Melanocortin 2 receptor accessory protein
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MRAP Antibody?

The catalog number for Recombinant MRAP Antibody is RN-14662.

What sizes are available for Recombinant MRAP Antibody?

Recombinant MRAP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MRAP Antibody come in?

Recombinant MRAP Antibody is available in 3 different pack sizes.

Is Recombinant MRAP Antibody in stock?

Recombinant MRAP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

All Products