Recombinant Desmoglein-2 Antibody

Catalog number RC-16878-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-16878-01

Size / count 50 μL

Specifications

Catalog number: RC-16878-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Desmoglein-2, Cadherin family member 5, HDGC
Gene Name: DSG2
Gene ID: 1829
UniProt: Q14126
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human Desmoglein 2
Partner Proteins: Desmoglein-2; Cadherin family member 5; HDGC
Clone: K01_4T06
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: QPTLAMPNIAVGQNVTVTERVLAPASTLQSSYQIPTENSMTARNTTVSGAGVPGPLPDFGLEESGHSNSTITTSSTRVTKHSTVQHSYS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: CDHF5
Target Alternative Name: Desmoglein-2
Host or Source: Rabbit
Protein Name: Desmoglein 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Desmoglein-2 Antibody?

The catalog number for Recombinant Desmoglein-2 Antibody is RC-16878.

What sizes are available for Recombinant Desmoglein-2 Antibody?

Recombinant Desmoglein-2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Desmoglein-2 Antibody come in?

Recombinant Desmoglein-2 Antibody is available in 3 different pack sizes.

Is Recombinant Desmoglein-2 Antibody in stock?

Recombinant Desmoglein-2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.