Recombinant UBASH3A Antibody

Catalog number RN-14747-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14747-01

Size / count 50 μL

Specifications

Catalog number: RN-14747-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ubiquitin-associated and SH3 domain-containing protein A, Cbl-interacting protein 4, CLIP4, Suppressor of T-cell receptor signaling 2, STS-2, T-cell ubiquitin ligand 1, TULA-1
Gene Name: UBASH3A
Gene ID: 53347
UniProt: P57075
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human UBASH3A
Target: PP-4934
Partner Proteins: Ubiquitin-associated and SH3 domain-containing protein A; Cbl-interacting protein 4; CLIP4; Suppressor of T-cell receptor signaling 2; STS-2; T-cell ubiquitin ligand 1; TULA-1
Clone: KCA025_4D8
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 81%, Pig - 82%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANA
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 81%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: STS2
Target Alternative Name: UBASH3A
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Ubiquitin associated and SH3 domain containing A
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant UBASH3A Antibody?

The catalog number for Recombinant UBASH3A Antibody is RN-14747.

What sizes are available for Recombinant UBASH3A Antibody?

Recombinant UBASH3A Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant UBASH3A Antibody come in?

Recombinant UBASH3A Antibody is available in 3 different pack sizes.

Is Recombinant UBASH3A Antibody in stock?

Recombinant UBASH3A Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

Can I return this product if I ordered the wrong one?

As a consumer, you have a 14-day right of withdrawal from receipt under EU consumer protection law, submitted via our withdrawal/cancellation request form. Note this applies to unused, undamaged products, and doesn’t override the expiry/storage conditions on performance-based claims.