Recombinant HADHB Antibody

Catalog number RN-14671-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14671-01

Size / count 50 μL

Specifications

Catalog number: RN-14671-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Trifunctional enzyme subunit beta, mitochondrial, TP-beta) [Includes: 3-ketoacyl-CoA thiolase, Acetyl-CoA acyltransferase, Beta-ketothiolase]
Gene Name: HADHB
Gene ID: 3032
UniProt: P55084
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HADHB
Target: PP-9392
Partner Proteins: Trifunctional enzyme subunit beta; mitochondrial; TP-beta) [Includes: 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase]
Clone: K29112_20C2
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 89%, Pig - 93%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: KTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: HADHB
Host or Source: Mouse
Protein Name: Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HADHB Antibody?

The catalog number for Recombinant HADHB Antibody is RN-14671.

What sizes are available for Recombinant HADHB Antibody?

Recombinant HADHB Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HADHB Antibody come in?

Recombinant HADHB Antibody is available in 3 different pack sizes.

Is Recombinant HADHB Antibody in stock?

Recombinant HADHB Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.