Recombinant SOX2 Antibody — image 1 of 3

Product details

Recombinant SOX2 Antibody

Catalog number RC-16393-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-16393-01

Size / count 50 μL

Specifications

Catalog number: RC-16393-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription factor SOX-2
Gene Name: SOX2
Gene ID: 6657
UniProt: P48431
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human SOX2
Partner Proteins: Transcription factor SOX-2
Clone: K01_4N15
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Purity: ≥85%
Cores: MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFID
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
WB Dilution: 1:500~1:1000
IF Dilution: 1:50~1:200
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: SOX2
Panel Description: IHC Pathology, Neuroscience Biomarkers, DNA binding & Chromatin, Ferroptosis, Transcription Factors
Host or Source: Rabbit
Protein Name: SRY-box transcription factor 2
WB Description: Succeed
IHC description: Succeed
IF/ICC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant SOX2 Antibody?

The catalog number for Recombinant SOX2 Antibody is RC-16393.

What sizes are available for Recombinant SOX2 Antibody?

Recombinant SOX2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant SOX2 Antibody come in?

Recombinant SOX2 Antibody is available in 3 different pack sizes.

Is Recombinant SOX2 Antibody in stock?

Recombinant SOX2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.