Product details

Recombinant p21 Antibody

Catalog number RC-16837-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-16837-01

Size / count 50 μL

Specifications

Catalog number: RC-16837-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cyclin-dependent kinase inhibitor 1, CDK-interacting protein 1, Melanoma differentiation-associated protein 6, MDA-6, p21
Gene Name: CDKN1A
Gene ID: 1026
UniProt: P38936
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human p21
Partner Proteins: Cyclin-dependent kinase inhibitor 1; CDK-interacting protein 1; Melanoma differentiation-associated protein 6; MDA-6; p21
Clone: K01_4S64
Conjugation: Unconjugated
Applications: WB&ICC/IF
Validation: WB&ICC/IF
Purity: ≥85%
Cores: HVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
IF Dilution: 1:50~1:200
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: CAP20; CDKN1; CIP1; MDA6; PIC1; SDI1; WAF1
Target Alternative Name: P21
Panel Description: IHC Pathology, Ferroptosis
Host or Source: Rabbit
Protein Name: Cyclin dependent kinase inhibitor 1A
WB Description: Succeed
IF/ICC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant p21 Antibody?

The catalog number for Recombinant p21 Antibody is RC-16837.

What sizes are available for Recombinant p21 Antibody?

Recombinant p21 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant p21 Antibody come in?

Recombinant p21 Antibody is available in 3 different pack sizes.

Is Recombinant p21 Antibody in stock?

Recombinant p21 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

All Products