Caspase-1 Antibody

Catalog number KC-38029-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-38029-01

Size / count 50 μL

Specifications

Catalog number: KC-38029-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Caspase-1, CASP-1, Interleukin-1 beta convertase, IL-1BC, Interleukin-1 beta-converting enzyme, ICE, IL-1 beta-converting enzyme, p45) [Cleaved into: Caspase-1 subunit p20, Caspase-1 subunit p10]
Gene Name: CASP1
Gene ID: 834
UniProt: P29466
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CASP1
Target: PP-1837
Partner Proteins: Caspase-1; CASP-1; Interleukin-1 beta convertase; IL-1BC; Interleukin-1 beta-converting enzyme; ICE; IL-1 beta-converting enzyme; p45) [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]
Clone: K9N054_14F9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 62%, Rat - 63%, Pig - 73%, Cynomolgus monkey - 89%
Purity: ≥85%
Cores: MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 62%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: IL1BC; IL1BCE
Target Alternative Name: Caspase-1
Host or Source: Mouse
Protein Name: Caspase 1
WB Description: Fail (THP-1)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Caspase-1 Antibody?

The catalog number for Caspase-1 Antibody is KC-38029.

What sizes are available for Caspase-1 Antibody?

Caspase-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Caspase-1 Antibody come in?

Caspase-1 Antibody is available in 3 different pack sizes.

Is Caspase-1 Antibody in stock?

Caspase-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

All Products