Recombinant CD26 Antibody

Catalog number RC-15207-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15207-01

Size / count 50 μL

Specifications

Catalog number: RC-15207-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Dipeptidyl peptidase 4, ADABP, Adenosine deaminase complexing protein 2, ADCP-2, Dipeptidyl peptidase IV, DPP IV, T-cell activation antigen CD26, TP103, CD antigen CD26) [Cleaved into: Dipeptidyl peptidase 4 membrane form, Dipeptidyl peptidase IV membrane form, Dipeptidyl peptidase 4 soluble form, Dipeptidyl peptidase IV soluble form]
Gene Name: DPP4
Gene ID: 1803
UniProt: P27487
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human CD26
Target Antigen: CD26
Partner Proteins: Dipeptidyl peptidase 4; ADABP; Adenosine deaminase complexing protein 2; ADCP-2; Dipeptidyl peptidase IV; DPP IV; T-cell activation antigen CD26; TP103; CD antigen CD26) [Cleaved into: Dipeptidyl peptidase 4 membrane form; Dipeptidyl peptidase IV membrane form; Dipeptidyl peptidase 4 soluble form; Dipeptidyl peptidase IV soluble form]
Clone: K01_3Q16
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: VHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: ADCP2; CD26
Target Alternative Name: CD26
Panel Description: CD Antigen, Ferroptosis
Host or Source: Rabbit
Protein Name: Dipeptidyl peptidase 4
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant CD26 Antibody?

The catalog number for Recombinant CD26 Antibody is RC-15207.

What sizes are available for Recombinant CD26 Antibody?

Recombinant CD26 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CD26 Antibody come in?

Recombinant CD26 Antibody is available in 3 different pack sizes.

Is Recombinant CD26 Antibody in stock?

Recombinant CD26 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products