Recombinant GCSH Antibody — image 1 of 2

Product details

Recombinant GCSH Antibody

Catalog number RN-14738-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14738-01

Size / count 50 μL

Specifications

Catalog number: RN-14738-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Glycine cleavage system H protein, mitochondrial, Lipoic acid-containing protein
Gene Name: GCSH
Gene ID: 2653
UniProt: P23434
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GCSH
Target: PP-5753
Partner Proteins: Glycine cleavage system H protein; mitochondrial; Lipoic acid-containing protein
Clone: K92101_14G4
Conjugation: Unconjugated
Applications: Top_IHC&Top_WB
Validation: Top_IHC&Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: TTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: GCSH
Host or Source: Mouse
Protein Name: Glycine cleavage system protein H
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant GCSH Antibody?

The catalog number for Recombinant GCSH Antibody is RN-14738.

What sizes are available for Recombinant GCSH Antibody?

Recombinant GCSH Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant GCSH Antibody come in?

Recombinant GCSH Antibody is available in 3 different pack sizes.

Is Recombinant GCSH Antibody in stock?

Recombinant GCSH Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.