Recombinant Integrin alpha-6 Antibody — image 1 of 2

Product details

Recombinant Integrin alpha-6 Antibody

Catalog number RC-15404-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15404-01

Size / count 50 μL

Specifications

Catalog number: RC-15404-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Integrin alpha-6, CD49 antigen-like family member F, VLA-6, CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain, Integrin alpha-6 light chain, Processed integrin alpha-6, Alpha6p]
Gene Name: ITGA6
Gene ID: 3655
UniProt: P23229
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human Integrin alpha 6
Target Antigen: CD49f
Partner Proteins: Integrin alpha-6; CD49 antigen-like family member F; VLA-6; CD antigen CD49f) [Cleaved into: Integrin alpha-6 heavy chain; Integrin alpha-6 light chain; Processed integrin alpha-6; Alpha6p]
Clone: K01_3S15
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Purity: ≥85%
Cores: MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQR
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: Integrin alpha-6
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: Integrin subunit alpha 6
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Integrin alpha-6 Antibody?

The catalog number for Recombinant Integrin alpha-6 Antibody is RC-15404.

What sizes are available for Recombinant Integrin alpha-6 Antibody?

Recombinant Integrin alpha-6 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Integrin alpha-6 Antibody come in?

Recombinant Integrin alpha-6 Antibody is available in 3 different pack sizes.

Is Recombinant Integrin alpha-6 Antibody in stock?

Recombinant Integrin alpha-6 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

All Products