Recombinant CD22 Antibody

Catalog number RN-090-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-090-01

Size / count 50 μL

Specifications

Catalog number: RN-090-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: B-cell receptor CD22, B-lymphocyte cell adhesion molecule, BL-CAM, Sialic acid-binding Ig-like lectin 2, Siglec-2, T-cell surface antigen Leu-14, CD antigen CD22
Gene Name: CD22
Gene ID: 933
UniProt: P20273
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CD22
Target Antigen: CD22
Target: PP-561
Partner Proteins: B-cell receptor CD22; B-lymphocyte cell adhesion molecule; BL-CAM; Sialic acid-binding Ig-like lectin 2; Siglec-2; T-cell surface antigen Leu-14; CD antigen CD22
Clone: K92013_7A12
Conjugation: Unconjugated
Applications: FC
Validation: FC
Dilution: 1:100
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 67%, Pig - 65%, Cynomolgus monkey - 92%
Purity: ≥85%
Cores: LQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENV
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 67%
Recombinant Antibody: Yes
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SIGLEC2
Target Alternative Name: CD22
Panel Description: IHC Pathology, CD Antigen
Host or Source: Mouse
Protein Name: CD22 molecule
FC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CD22 Antibody?

The catalog number for Recombinant CD22 Antibody is RN-090.

What sizes are available for Recombinant CD22 Antibody?

Recombinant CD22 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CD22 Antibody come in?

Recombinant CD22 Antibody is available in 3 different pack sizes.

Is Recombinant CD22 Antibody in stock?

Recombinant CD22 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

All Products