Recombinant 12 Lipoxygenase Antibody

Catalog number RC-15041-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15041-01

Size / count 50 μL

Specifications

Catalog number: RC-15041-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Polyunsaturated fatty acid lipoxygenase ALOX12, Arachidonate, 12S) -lipoxygenase, 12S-LOX, 12S-lipoxygenase, Arachidonate, 15S) -lipoxygenase, Linoleate, 13S) -lipoxygenase, Lipoxin synthase 12-LO, Platelet-type lipoxygenase 12
Gene Name: ALOX12
Gene ID: 239
UniProt: P18054
Antigen Species: Human
Reactivity: Human, Rat
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human LOX12
Partner Proteins: Polyunsaturated fatty acid lipoxygenase ALOX12; Arachidonate; 12S) -lipoxygenase; 12S-LOX; 12S-lipoxygenase; Arachidonate; 15S) -lipoxygenase; Linoleate; 13S) -lipoxygenase; Lipoxin synthase 12-LO; Platelet-type lipoxygenase 12
Clone: K01_3N48
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: RQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENSVTI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: 12LO; LOG12
Target Alternative Name: 12 Lipoxygenase
Panel Description: Ferroptosis
Host or Source: Rabbit
Protein Name: Arachidonate 12-lipoxygenase, 12S type
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant 12 Lipoxygenase Antibody?

The catalog number for Recombinant 12 Lipoxygenase Antibody is RC-15041.

What sizes are available for Recombinant 12 Lipoxygenase Antibody?

Recombinant 12 Lipoxygenase Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant 12 Lipoxygenase Antibody come in?

Recombinant 12 Lipoxygenase Antibody is available in 3 different pack sizes.

Is Recombinant 12 Lipoxygenase Antibody in stock?

Recombinant 12 Lipoxygenase Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

All Products