Recombinant EpCAM Antibody — image 1 of 2

Product details

Recombinant EpCAM Antibody

Catalog number RC-15455-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15455-01

Size / count 50 μL

Specifications

Catalog number: RC-15455-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Epithelial cell adhesion molecule, Ep-CAM, Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein, EGP, Epithelial glycoprotein 314, EGP314, hEGP314, KS 1/4 antigen, KSA, Major gastrointestinal tumor-associated protein GA733-2, Tumor-associated calcium signal transducer 1, CD antigen CD326
Gene Name: EPCAM
Gene ID: 4072
UniProt: P16422
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human EpCAM
Target Antigen: CD326
Partner Proteins: Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326
Clone: K01_3S66
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Purity: ≥85%
Cores: QNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQC
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: GA733-2; M1S2; M4S1; MIC18; TACSTD1; TROP1
Target Alternative Name: EpCAM
Panel Description: IHC Pathology, CD Antigen
Host or Source: Rabbit
Protein Name: Epithelial cell adhesion molecule
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant EpCAM Antibody?

The catalog number for Recombinant EpCAM Antibody is RC-15455.

What sizes are available for Recombinant EpCAM Antibody?

Recombinant EpCAM Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant EpCAM Antibody come in?

Recombinant EpCAM Antibody is available in 3 different pack sizes.

Is Recombinant EpCAM Antibody in stock?

Recombinant EpCAM Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.