Recombinant Mucin-1 Antibody — image 1 of 2

Product details

Recombinant Mucin-1 Antibody

Catalog number RC-15444-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15444-01

Size / count 50 μL

Specifications

Catalog number: RC-15444-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Mucin-1, MUC-1, Breast carcinoma-associated antigen DF3, Cancer antigen 15-3, CA 15-3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive urinary mucin, PUM, Polymorphic epithelial mucin, PEM, Tumor-associated epithelial membrane antigen, EMA, Tumor-associated mucin, CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha, MUC1-NT, MUC1-alpha, Mucin-1 subunit beta, MUC1-beta, MUC1-CT]
Gene Name: MUC1
Gene ID: 4582
UniProt: P15941
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human MUC1
Target Antigen: CD227
Partner Proteins: Mucin-1; MUC-1; Breast carcinoma-associated antigen DF3; Cancer antigen 15-3; CA 15-3; Carcinoma-associated mucin; Episialin; H23AG; Krebs von den Lungen-6; KL-6; PEMT; Peanut-reactive urinary mucin; PUM; Polymorphic epithelial mucin; PEM; Tumor-associated epithelial membrane antigen; EMA; Tumor-associated mucin; CD antigen CD227) [Cleaved into: Mucin-1 subunit alpha; MUC1-NT; MUC1-alpha; Mucin-1 subunit beta; MUC1-beta; MUC1-CT]
Clone: K01_3S55
Conjugation: Unconjugated
Applications: IHC&WB
Validation: IHC&WB
Purity: ≥85%
Cores: QCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: PUM
Target Alternative Name: Mucin-1
Panel Description: IHC Pathology, Autoimmune Disease, CD Antigen, Ferroptosis
Host or Source: Rabbit
Protein Name: Mucin 1, cell surface associated
WB Description: Succeed
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Mucin-1 Antibody?

The catalog number for Recombinant Mucin-1 Antibody is RC-15444.

What sizes are available for Recombinant Mucin-1 Antibody?

Recombinant Mucin-1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Mucin-1 Antibody come in?

Recombinant Mucin-1 Antibody is available in 3 different pack sizes.

Is Recombinant Mucin-1 Antibody in stock?

Recombinant Mucin-1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

All Products