Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody — image 1 of 3

Product details

Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody

Catalog number RC-15225-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15225-01

Size / count 50 μL

Specifications

Catalog number: RC-15225-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Carcinoembryonic antigen-related cell adhesion molecule 5, Carcinoembryonic antigen, CEA, Meconium antigen 100, CD antigen CD66e
Gene Name: CEACAM5
Gene ID: 1048
UniProt: P06731
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human CEA (CD66e)
Target Antigen: CD66e
Partner Proteins: Carcinoembryonic antigen-related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD antigen CD66e
Clone: K01_3Q34
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Purity: ≥85%
Cores: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
IF Dilution: 1:50~1:200
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: CEA
Target Alternative Name: Carcino Embryonic Antigen CEA (CD66e)
Panel Description: CD Antigen
Host or Source: Rabbit
Protein Name: CEA cell adhesion molecule 5
WB Description: Succeed
IHC description: Succeed
IF/ICC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody?

The catalog number for Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody is RC-15225.

What sizes are available for Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody?

Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody come in?

Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody is available in 3 different pack sizes.

Is Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody in stock?

Recombinant Carcino Embryonic Antigen CEA (CD66e) Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.