Product details

PKC-gamma Antibody

Catalog number KC-17361-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-17361-01

Size / count 50 μL

Specifications

Catalog number: KC-17361-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein kinase C gamma type, PKC-gamma
Gene Name: PRKCG
Gene ID: 5582
UniProt: P05129
Antigen Species: Human
Reactivity: Mouse, Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKCG
Target: PP-10663
Partner Proteins: Protein kinase C gamma type; PKC-gamma
Clone: K52063_16A11
Conjugation: Unconjugated
Applications: Top_IHC&Top_IP/ChIP
Validation: Top_IHC&Top_IP/ChIP
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 98%, Rat - 98%, Pig - 99%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: LQLEIRAPTADEIHVTVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 98%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
IP Dilution: 1:100
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PKCG
Target Alternative Name: PKC-gamma
Panel Description: Neurodegenerative Diseases Marker, Ferroptosis
Host or Source: Mouse
Protein Name: Protein kinase C gamma
IHC description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PKC-gamma Antibody?

The catalog number for PKC-gamma Antibody is KC-17361.

What sizes are available for PKC-gamma Antibody?

PKC-gamma Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PKC-gamma Antibody come in?

PKC-gamma Antibody is available in 3 different pack sizes.

Is PKC-gamma Antibody in stock?

PKC-gamma Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

All Products