Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody — image 1 of 2

Product details

Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody

Catalog number RC-15177-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15177-01

Size / count 50 μL

Specifications

Catalog number: RC-15177-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: HLA class II histocompatibility antigen, DQ alpha 1 chain, DC-1 alpha chain, DC-alpha, HLA-DCA, MHC class II DQA1
Gene Name: HLA-DQA1
Gene ID: 3117
UniProt: P01909
Antigen Species: Human
Reactivity: Human, Mouse, Rat
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human HLA-DQA1
Partner Proteins: HLA class II histocompatibility antigen; DQ alpha 1 chain; DC-1 alpha chain; DC-alpha; HLA-DCA; MHC class II DQA1
Clone: K01_3P85
Conjugation: Unconjugated
Applications: IP/ChIP&WB
Validation: IP/ChIP&WB
Purity: ≥85%
Cores: KPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:1000
IP Dilution: 1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: HLA-DQA1/HLA-DPA1/HLA-DRB1
Host or Source: Rabbit
Protein Name: Major histocompatibility complex, class II, DQ alpha 1
WB Description: Succeed
IP description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody?

The catalog number for Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody is RC-15177.

What sizes are available for Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody?

Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody come in?

Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody is available in 3 different pack sizes.

Is Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody in stock?

Recombinant HLA-DQA1/HLA-DPA1/HLA-DRB1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.