Recombinant Survivin Antibody — image 1 of 3

Product details

Recombinant Survivin Antibody

Catalog number RC-15330-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-15330-01

Size / count 50 μL

Specifications

Catalog number: RC-15330-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Baculoviral IAP repeat-containing protein 5, Apoptosis inhibitor 4, Apoptosis inhibitor survivin
Gene Name: BIRC5
Gene ID: 332
UniProt: O15392
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human Survivin
Partner Proteins: Baculoviral IAP repeat-containing protein 5; Apoptosis inhibitor 4; Apoptosis inhibitor survivin
Clone: K01_3R40
Conjugation: Unconjugated
Applications: IHC&WB&ICC/IF
Validation: IHC&WB&ICC/IF
Purity: ≥85%
Cores: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
IHC Dilution: 1:50~1:100
WB Dilution: 1:500~1:1000
IF Dilution: 1:50~1:200
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: API4; IAP4
Target Alternative Name: Survivin
Panel Description: IHC Pathology, Neuroscience Biomarkers
Host or Source: Rabbit
Protein Name: Baculoviral IAP repeat containing 5
WB Description: Succeed
IHC description: Succeed
IF/ICC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Survivin Antibody?

The catalog number for Recombinant Survivin Antibody is RC-15330.

What sizes are available for Recombinant Survivin Antibody?

Recombinant Survivin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Survivin Antibody come in?

Recombinant Survivin Antibody is available in 3 different pack sizes.

Is Recombinant Survivin Antibody in stock?

Recombinant Survivin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.