Recombinant Ubiquitin D Antibody — image 1 of 2

Product details

Recombinant Ubiquitin D Antibody

Catalog number RC-16669-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RC-16669-01

Size / count 50 μL

Specifications

Catalog number: RC-16669-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ubiquitin D, Diubiquitin, Ubiquitin-like protein FAT10
Gene Name: UBD
Gene ID: 10537
UniProt: O15205
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: A synthesized peptide derived from human Ubiquitin D
Partner Proteins: Ubiquitin D; Diubiquitin; Ubiquitin-like protein FAT10
Clone: K01_4Q94
Conjugation: Unconjugated
Applications: WB
Validation: WB
Purity: ≥85%
Cores: KRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Recombinant Antibody: Yes
WB Dilution: 1:500~1:1000
Formulation: 10mM PBS, pH 7.4, 150mM sodium chloride, 0.05% BSA, 0.02% sodium azide and 50% glycerol.
Antibody Type: Monoclonal
Gene Name Synonym: FAT10
Target Alternative Name: Ubiquitin D
Host or Source: Rabbit
Protein Name: Ubiquitin D
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG

Frequently Asked Questions

What is the catalog number for Recombinant Ubiquitin D Antibody?

The catalog number for Recombinant Ubiquitin D Antibody is RC-16669.

What sizes are available for Recombinant Ubiquitin D Antibody?

Recombinant Ubiquitin D Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant Ubiquitin D Antibody come in?

Recombinant Ubiquitin D Antibody is available in 3 different pack sizes.

Is Recombinant Ubiquitin D Antibody in stock?

Recombinant Ubiquitin D Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.