Product details

PALM2AKAP2 Antibody

Catalog number KC-37370-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-37370-01

Size / count 50 μL

Specifications

Catalog number: KC-37370-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: PALM2-AKAP2 fusion protein, A-kinase anchor protein 2, AKAP-2, AKAP-KL, Paralemmin A kinase anchor protein, Paralemmin-2, Protein kinase A-anchoring protein 2, PRKA2
Gene Name: PALM2AKAP2
Gene ID: 445815
UniProt: Q9Y2D5
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human AKAP2
Target: PP-8452
Partner Proteins: PALM2-AKAP2 fusion protein; A-kinase anchor protein 2; AKAP-2; AKAP-KL; Paralemmin A kinase anchor protein; Paralemmin-2; Protein kinase A-anchoring protein 2; PRKA2
Clone: K8U062_12A9
Conjugation: Unconjugated
Applications: Top_IHC&ELISA
Validation: Top_IHC&ELISA
Detection Method: Succeed
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 91%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: TTLKKEAKFELRAFHEDKKPSKLFEDDEHEKEQYCIRKVRPSEEMLELEKERRELIRSQAVKKNPGIAAKWWNPPQEKTIEEQLDEEHLESHKKYKERKERRAQQEQLLLQKQLQQQQQQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Sandwich ELISA Dilution: 1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA0920; PAKAP; PALM2
Target Alternative Name: PALM2AKAP2
Host or Source: Mouse
Protein Name: PALM2 and AKAP2 fusion
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for PALM2AKAP2 Antibody?

The catalog number for PALM2AKAP2 Antibody is KC-37370.

What sizes are available for PALM2AKAP2 Antibody?

PALM2AKAP2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does PALM2AKAP2 Antibody come in?

PALM2AKAP2 Antibody is available in 3 different pack sizes.

Is PALM2AKAP2 Antibody in stock?

PALM2AKAP2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.