Recombinant POMP Antibody

Catalog number RN-14666-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14666-01

Size / count 50 μL

Specifications

Catalog number: RN-14666-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proteasome maturation protein, Proteassemblin, Protein UMP1 homolog, hUMP1, Voltage-gated K channel beta subunit 4.1
Gene Name: POMP
Gene ID: 51371
UniProt: Q9Y244
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human POMP
Target: PP-8409
Partner Proteins: Proteasome maturation protein; Proteassemblin; Protein UMP1 homolog; hUMP1; Voltage-gated K channel beta subunit 4.1
Clone: K8U060_6D2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: KDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: C13orf12; UMP1
Target Alternative Name: POMP
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Proteasome maturation protein
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant POMP Antibody?

The catalog number for Recombinant POMP Antibody is RN-14666.

What sizes are available for Recombinant POMP Antibody?

Recombinant POMP Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant POMP Antibody come in?

Recombinant POMP Antibody is available in 3 different pack sizes.

Is Recombinant POMP Antibody in stock?

Recombinant POMP Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

All Products