Recombinant ANKRD2 Antibody

Catalog number RN-14889-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14889-01

Size / count 50 μL

Specifications

Catalog number: RN-14889-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ankyrin repeat domain-containing protein 2, Skeletal muscle ankyrin repeat protein, hArpp
Gene Name: ANKRD2
Gene ID: 26287
UniProt: Q9GZV1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ANKRD2
Target: PP-4161
Partner Proteins: Ankyrin repeat domain-containing protein 2; Skeletal muscle ankyrin repeat protein; hArpp
Clone: K9N070_18B6
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 89%, Rat - 59%, Pig - 89%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 89%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: ARPP
Target Alternative Name: ANKRD2
Host or Source: Mouse
Protein Name: Ankyrin repeat domain 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ANKRD2 Antibody?

The catalog number for Recombinant ANKRD2 Antibody is RN-14889.

What sizes are available for Recombinant ANKRD2 Antibody?

Recombinant ANKRD2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ANKRD2 Antibody come in?

Recombinant ANKRD2 Antibody is available in 3 different pack sizes.

Is Recombinant ANKRD2 Antibody in stock?

Recombinant ANKRD2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Do you ship this product with dry ice?

Some products, including certain cell lines and biologics, require dry ice for transportation, which carries an additional fee shown clearly in your quotation. Dry ice delivery isn’t always possible to every destination due to transit time or local restrictions, so we check feasibility in advance and you must store the goods at the correct temperature the moment they arrive.

All Products