Recombinant HIBADH Antibody

Catalog number RN-14726-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14726-01

Size / count 50 μL

Specifications

Catalog number: RN-14726-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 3-hydroxyisobutyrate dehydrogenase, mitochondrial, HIBADH
Gene Name: HIBADH
Gene ID: 11112
UniProt: P31937
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human HIBADH
Target: PP-3943
Partner Proteins: 3-hydroxyisobutyrate dehydrogenase; mitochondrial; HIBADH
Clone: K1E094_7F8
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: ASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 93%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: HIBADH
Host or Source: Mouse
Protein Name: 3-Hydroxyisobutyrate dehydrogenase
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant HIBADH Antibody?

The catalog number for Recombinant HIBADH Antibody is RN-14726.

What sizes are available for Recombinant HIBADH Antibody?

Recombinant HIBADH Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant HIBADH Antibody come in?

Recombinant HIBADH Antibody is available in 3 different pack sizes.

Is Recombinant HIBADH Antibody in stock?

Recombinant HIBADH Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.