AMPK beta 1 Antibody

Catalog number KC-45773-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-45773-01

Size / count 50 μL

Specifications

Catalog number: KC-45773-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: 5'-AMP-activated protein kinase subunit beta-1, AMPK subunit beta-1, AMPKb
Gene Name: PRKAB1
Gene ID: 5564
UniProt: Q9Y478
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human PRKAB1
Target: PP-1033
Partner Proteins: 5'-AMP-activated protein kinase subunit beta-1; AMPK subunit beta-1; AMPKb
Clone: K40116_8G11
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 94%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: LERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: AMPK
Target Alternative Name: AMPK beta 1
Host or Source: Mouse
Protein Name: Protein kinase AMP-activated non-catalytic subunit beta 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for AMPK beta 1 Antibody?

The catalog number for AMPK beta 1 Antibody is KC-45773.

What sizes are available for AMPK beta 1 Antibody?

AMPK beta 1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does AMPK beta 1 Antibody come in?

AMPK beta 1 Antibody is available in 3 different pack sizes.

Is AMPK beta 1 Antibody in stock?

AMPK beta 1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

All Products