Recombinant COA3 Antibody

Catalog number RN-14970-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14970-01

Size / count 50 μL

Specifications

Catalog number: RN-14970-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cytochrome c oxidase assembly factor 3 homolog, mitochondrial, Coiled-coil domain-containing protein 56, Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa
Gene Name: COA3
Gene ID: 28958
UniProt: Q9Y2R0
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human COA3
Target: PP-12563
Partner Proteins: Cytochrome c oxidase assembly factor 3 homolog; mitochondrial; Coiled-coil domain-containing protein 56; Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 12 kDa
Clone: K7L014_16E8
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 75%, Pig - 77%, Cynomolgus monkey - 88%
Purity: ≥85%
Cores: DSKRGEAPFAQRIDPTREKLTPEQLHSMRQAELAQWQKVL
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 75%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CCDC56; MITRAC12
Target Alternative Name: COA3
Host or Source: Mouse
Protein Name: Cytochrome c oxidase assembly factor 3
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant COA3 Antibody?

The catalog number for Recombinant COA3 Antibody is RN-14970.

What sizes are available for Recombinant COA3 Antibody?

Recombinant COA3 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant COA3 Antibody come in?

Recombinant COA3 Antibody is available in 3 different pack sizes.

Is Recombinant COA3 Antibody in stock?

Recombinant COA3 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

What is the recommended storage temperature after reconstitution?

Post-reconstitution storage guidance is listed on the datasheet, typically requiring aliquoting and storage at -20°C or -80°C to preserve activity.

Can this product be used in multiplex assays?

Multiplex compatibility depends on the specific product and detection panel. Contact our technical support team with details of your multiplex system for guidance before ordering.

All Products