Recombinant USP20 Antibody

Catalog number RN-14710-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14710-01

Size / count 50 μL

Specifications

Catalog number: RN-14710-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Ubiquitin carboxyl-terminal hydrolase 20, Deubiquitinating enzyme 20, Ubiquitin thioesterase 20, Ubiquitin-specific-processing protease 20, VHL-interacting deubiquitinating enzyme 2, hVDU2
Gene Name: USP20
Gene ID: 10868
UniProt: Q9Y2K6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human USP20
Target: PP-7431
Partner Proteins: Ubiquitin carboxyl-terminal hydrolase 20; Deubiquitinating enzyme 20; Ubiquitin thioesterase 20; Ubiquitin-specific-processing protease 20; VHL-interacting deubiquitinating enzyme 2; hVDU2
Clone: KCA020_12G10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 36%, Pig - 94%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: AKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPGPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
IHC Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: KIAA1003; LSFR3A; VDU2
Target Alternative Name: USP20
Panel Description: Ferroptosis, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Ubiquitin specific peptidase 20
WB Description: Fail (Raji)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant USP20 Antibody?

The catalog number for Recombinant USP20 Antibody is RN-14710.

What sizes are available for Recombinant USP20 Antibody?

Recombinant USP20 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant USP20 Antibody come in?

Recombinant USP20 Antibody is available in 3 different pack sizes.

Is Recombinant USP20 Antibody in stock?

Recombinant USP20 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

All Products