Product details

CaMKII alpha Antibody

Catalog number KC-35854-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-35854-01

Size / count 50 μL

Specifications

Catalog number: KC-35854-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Calcium/calmodulin-dependent protein kinase type II subunit alpha, CaM kinase II subunit alpha, CaMK-II subunit alpha
Gene Name: CAMK2A
Gene ID: 815
UniProt: Q9UQM7
Antigen Species: Human
Reactivity: Human, Mouse
Cross Reactivity: Not tested
Immunogen: Recombinant human CAMK2A
Target: P66790PB
Partner Proteins: Calcium/calmodulin-dependent protein kinase type II subunit alpha; CaM kinase II subunit alpha; CaMK-II subunit alpha
Clone: K29108_6B4
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 91%
Purity: ≥85%
Cores: KKFNARRKLKGAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 99%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CAMKA; KIAA0968
Target Alternative Name: CaMKII alpha
Panel Description: Neuroscience Biomarkers
Host or Source: Mouse
Protein Name: Calcium/calmodulin dependent protein kinase II alpha
WB Description: Fail (Mouse Brain)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for CaMKII alpha Antibody?

The catalog number for CaMKII alpha Antibody is KC-35854.

What sizes are available for CaMKII alpha Antibody?

CaMKII alpha Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does CaMKII alpha Antibody come in?

CaMKII alpha Antibody is available in 3 different pack sizes.

Is CaMKII alpha Antibody in stock?

CaMKII alpha Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products