Recombinant MSRB1 Antibody

Catalog number RN-14914-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14914-01

Size / count 50 μL

Specifications

Catalog number: RN-14914-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Methionine-R-sulfoxide reductase B1, MsrB1, Selenoprotein X, SelX
Gene Name: MSRB1
Gene ID: 51734
UniProt: Q9NZV6
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MSRB1
Target: PP-11692
Partner Proteins: Methionine-R-sulfoxide reductase B1; MsrB1; Selenoprotein X; SelX
Clone: KBL018_20A12
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 93%, Pig - 91%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFUIFSSSLKFVPKGKETSASQGH
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SEPX1
Target Alternative Name: MSRB1
Host or Source: Mouse
Protein Name: Methionine sulfoxide reductase B1
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MSRB1 Antibody?

The catalog number for Recombinant MSRB1 Antibody is RN-14914.

What sizes are available for Recombinant MSRB1 Antibody?

Recombinant MSRB1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MSRB1 Antibody come in?

Recombinant MSRB1 Antibody is available in 3 different pack sizes.

Is Recombinant MSRB1 Antibody in stock?

Recombinant MSRB1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.