Recombinant UGGT1 Antibody

Catalog number RN-14886-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14886-01

Size / count 50 μL

Specifications

Catalog number: RN-14886-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: UDP-glucose:glycoprotein glucosyltransferase 1, UGT1, hUGT1, UDP--Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1
Gene Name: UGGT1
Gene ID: 56886
UniProt: Q9NYU2
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human UGGT1
Target: PP-5494
Partner Proteins: UDP-glucose:glycoprotein glucosyltransferase 1; UGT1; hUGT1; UDP--Glc:glycoprotein glucosyltransferase; UDP-glucose ceramide glucosyltransferase-like 1
Clone: K9N070_20E3
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: GFWDSFKWGFTGQKTEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 94%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: GT; UGCGL1; UGGT; UGT1; UGTR
Target Alternative Name: UGGT1
Host or Source: Mouse
Protein Name: UDP-glucose glycoprotein glucosyltransferase 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant UGGT1 Antibody?

The catalog number for Recombinant UGGT1 Antibody is RN-14886.

What sizes are available for Recombinant UGGT1 Antibody?

Recombinant UGGT1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant UGGT1 Antibody come in?

Recombinant UGGT1 Antibody is available in 3 different pack sizes.

Is Recombinant UGGT1 Antibody in stock?

Recombinant UGGT1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.