Recombinant C1orf50 Antibody

Catalog number RN-14956-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14956-01

Size / count 50 μL

Specifications

Catalog number: RN-14956-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Uncharacterized protein C1orf50
Gene Name: C1orf50
Gene ID: 79078
UniProt: Q9BV19
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human C1orf50
Target: PP-12524
Partner Proteins: Uncharacterized protein C1orf50
Clone: K24094_6B10
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 85%, Pig - 89%, Cynomolgus monkey - 96%
Purity: ≥85%
Cores: EGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQD
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 85%
Recombinant Antibody: Yes
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: C1orf50
Host or Source: Mouse
Protein Name: Chromosome 1 open reading frame 50
WB Description: Fail (Jurkat, HeLa)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant C1orf50 Antibody?

The catalog number for Recombinant C1orf50 Antibody is RN-14956.

What sizes are available for Recombinant C1orf50 Antibody?

Recombinant C1orf50 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant C1orf50 Antibody come in?

Recombinant C1orf50 Antibody is available in 3 different pack sizes.

Is Recombinant C1orf50 Antibody in stock?

Recombinant C1orf50 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

All Products