Recombinant MTERF2 Antibody

Catalog number RN-14808-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14808-01

Size / count 50 μL

Specifications

Catalog number: RN-14808-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Transcription termination factor 2, mitochondrial, Mitochondrial transcription termination factor 2, mTERF2, Mitochondrial transcription termination factor-like protein, mTERF-like, mTERFL, mTERF domain-containing protein 3, mitochondrial
Gene Name: MTERF2
Gene ID: 80298
UniProt: Q49AM1
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human MTERF2
Target: PP-7398
Partner Proteins: Transcription termination factor 2; mitochondrial; Mitochondrial transcription termination factor 2; mTERF2; Mitochondrial transcription termination factor-like protein; mTERF-like; mTERFL; mTERF domain-containing protein 3; mitochondrial
Clone: K8U069_5D9
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 80%, Rat - 79%, Pig - 86%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: LEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNPVEKNKQMVRILQESYLDVGG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 80%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: MTERFD3
Target Alternative Name: MTERF2
Panel Description: Transcription Factors
Host or Source: Mouse
Protein Name: Mitochondrial transcription termination factor 2
WB Description: Fail (Hep G2)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant MTERF2 Antibody?

The catalog number for Recombinant MTERF2 Antibody is RN-14808.

What sizes are available for Recombinant MTERF2 Antibody?

Recombinant MTERF2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant MTERF2 Antibody come in?

Recombinant MTERF2 Antibody is available in 3 different pack sizes.

Is Recombinant MTERF2 Antibody in stock?

Recombinant MTERF2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.