Recombinant CYCS Antibody

Catalog number RN-14945-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14945-01

Size / count 50 μL

Specifications

Catalog number: RN-14945-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Cytochrome c
Gene Name: CYCS
Gene ID: 54205
UniProt: P99999
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human CYCS
Target: PP-11258
Partner Proteins: Cytochrome c
Clone: K1E106_3C6
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 90%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 91%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: CYC
Target Alternative Name: CYCS
Host or Source: Mouse
Protein Name: Cytochrome c, somatic
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant CYCS Antibody?

The catalog number for Recombinant CYCS Antibody is RN-14945.

What sizes are available for Recombinant CYCS Antibody?

Recombinant CYCS Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant CYCS Antibody come in?

Recombinant CYCS Antibody is available in 3 different pack sizes.

Is Recombinant CYCS Antibody in stock?

Recombinant CYCS Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What happens if this product doesn’t perform as expected in my experiment?

Send us the catalogue number, product name, lot number, and a summary of your results. Our technical support team will investigate and, where needed, involve the manufacturer. This is covered under our guarantee provided the product was used before its expiry date and stored correctly.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

All Products