Recombinant DAB2 Antibody

Catalog number RN-14842-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14842-01

Size / count 50 μL

Specifications

Catalog number: RN-14842-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Disabled homolog 2, Adaptor molecule disabled-2, Differentially expressed in ovarian carcinoma 2, DOC-2, Differentially-expressed protein 2
Gene Name: DAB2
Gene ID: 1601
UniProt: P98082
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human DAB2
Target: PP-821
Partner Proteins: Disabled homolog 2; Adaptor molecule disabled-2; Differentially expressed in ovarian carcinoma 2; DOC-2; Differentially-expressed protein 2
Clone: K9N069_17E2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 96%, Cynomolgus monkey - 99%
Purity: ≥85%
Cores: NGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 96%
Recombinant Antibody: Yes
IHC Dilution: 1:250~1:500
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: DOC2
Target Alternative Name: DAB2
Host or Source: Mouse
Protein Name: DAB adaptor protein 2
WB Description: Fail (HeLa)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant DAB2 Antibody?

The catalog number for Recombinant DAB2 Antibody is RN-14842.

What sizes are available for Recombinant DAB2 Antibody?

Recombinant DAB2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant DAB2 Antibody come in?

Recombinant DAB2 Antibody is available in 3 different pack sizes.

Is Recombinant DAB2 Antibody in stock?

Recombinant DAB2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.