MAP1LC3B/GABARAPL2 Antibody

Catalog number KC-45060-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-45060-01

Size / count 50 μL

Specifications

Catalog number: KC-45060-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Gamma-aminobutyric acid receptor-associated protein-like 2, GABA (A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, Golgi-associated ATPase enhancer of 16 kDa, GATE-16, MAP1 light chain 3-related protein
Gene Name: GABARAPL2
Gene ID: 11345
UniProt: P60520
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human GABARAPL2
Target: PP-4940
Partner Proteins: Gamma-aminobutyric acid receptor-associated protein-like 2; GABA (A) receptor-associated protein-like 2; Ganglioside expression factor 2; GEF-2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; GATE-16; MAP1 light chain 3-related protein
Clone: K56086_1E10
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFG
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: FLC3A; GEF2
Target Alternative Name: MAP1LC3B/GABARAPL2
Panel Description: Ferroptosis
Host or Source: Mouse
Protein Name: GABA type A receptor associated protein like 2
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for MAP1LC3B/GABARAPL2 Antibody?

The catalog number for MAP1LC3B/GABARAPL2 Antibody is KC-45060.

What sizes are available for MAP1LC3B/GABARAPL2 Antibody?

MAP1LC3B/GABARAPL2 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does MAP1LC3B/GABARAPL2 Antibody come in?

MAP1LC3B/GABARAPL2 Antibody is available in 3 different pack sizes.

Is MAP1LC3B/GABARAPL2 Antibody in stock?

MAP1LC3B/GABARAPL2 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.

All Products