Recombinant INPP1 Antibody

Catalog number RN-14744-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14744-01

Size / count 50 μL

Specifications

Catalog number: RN-14744-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Inositol polyphosphate 1-phosphatase, IPP, IPPase
Gene Name: INPP1
Gene ID: 3628
UniProt: P49441
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human INPP1
Target: PP-801
Partner Proteins: Inositol polyphosphate 1-phosphatase; IPP; IPPase
Clone: K9N060_7B2
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Pig - 91%, Cynomolgus monkey - 98%
Purity: ≥85%
Cores: VSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKS
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Yes
IHC Dilution: 1:200~1:250
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: INPP1
Host or Source: Mouse
Protein Name: Inositol polyphosphate-1-phosphatase
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant INPP1 Antibody?

The catalog number for Recombinant INPP1 Antibody is RN-14744.

What sizes are available for Recombinant INPP1 Antibody?

Recombinant INPP1 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant INPP1 Antibody come in?

Recombinant INPP1 Antibody is available in 3 different pack sizes.

Is Recombinant INPP1 Antibody in stock?

Recombinant INPP1 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

All Products