Proteasome beta 9 Antibody

Catalog number KC-41831-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-41831-01

Size / count 50 μL

Specifications

Catalog number: KC-41831-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Proteasome subunit beta type-9, Low molecular mass protein 2, Macropain chain 7, Multicatalytic endopeptidase complex chain 7, Proteasome chain 7, Proteasome subunit beta-1i, Really interesting new gene 12 protein
Gene Name: PSMB9
Gene ID: 5698
UniProt: P28065
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PSMB9
Target: PP-4819
Partner Proteins: Proteasome subunit beta type-9; Low molecular mass protein 2; Macropain chain 7; Multicatalytic endopeptidase complex chain 7; Proteasome chain 7; Proteasome subunit beta-1i; Really interesting new gene 12 protein
Clone: K1H041_17G11
Conjugation: Unconjugated
Applications: Top_IHC
Validation: Top_IHC
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 95%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: TTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 90%
Recombinant Antibody: Not recombinant
IHC Dilution: 1:100~1:200
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: LMP2; PSMB6i; RING12
Target Alternative Name: Proteasome beta 9
Panel Description: Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Proteasome 20S subunit beta 9
WB Description: Fail (THP-1, U-937, Ramos)
IHC description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Proteasome beta 9 Antibody?

The catalog number for Proteasome beta 9 Antibody is KC-41831.

What sizes are available for Proteasome beta 9 Antibody?

Proteasome beta 9 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Proteasome beta 9 Antibody come in?

Proteasome beta 9 Antibody is available in 3 different pack sizes.

Is Proteasome beta 9 Antibody in stock?

Proteasome beta 9 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

How long will it take to receive this product if it’s custom made?

Lead times depend on the product type: custom polyclonal antibodies typically take 12-14 weeks, monoclonal antibodies 15-17 weeks, made-to-order recombinant proteins 4-8 weeks, and made-to-order recombinant antibodies 6-8 weeks. These are estimates and may shift due to production delays.

What is the recommended dilution for this antibody?

A recommended dilution range for each validated application is provided on the datasheet, but optimal dilution should be titrated for your specific experimental system, sample type, and detection method.