Alpha 1 Spectrin Antibody

Catalog number KC-42644-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-42644-01

Size / count 50 μL

Specifications

Catalog number: KC-42644-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Spectrin alpha chain, erythrocytic 1, Erythroid alpha-spectrin
Gene Name: SPTA1
Gene ID: 6708
UniProt: P02549
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human SPTA1
Target: PP-4167
Partner Proteins: Spectrin alpha chain; erythrocytic 1; Erythroid alpha-spectrin
Clone: K1H040_12F7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 73%, Rat - 53%, Pig - 73%, Cynomolgus monkey - 94%
Purity: ≥85%
Cores: ESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKRDADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRHLWDLLLELTLEK
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 73%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: SPTA
Target Alternative Name: Alpha 1 Spectrin
Host or Source: Mouse
Protein Name: Spectrin alpha, erythrocytic 1
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Alpha 1 Spectrin Antibody?

The catalog number for Alpha 1 Spectrin Antibody is KC-42644.

What sizes are available for Alpha 1 Spectrin Antibody?

Alpha 1 Spectrin Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Alpha 1 Spectrin Antibody come in?

Alpha 1 Spectrin Antibody is available in 3 different pack sizes.

Is Alpha 1 Spectrin Antibody in stock?

Alpha 1 Spectrin Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

All Products