Phospholipase A2 Activator Protein Antibody

Catalog number KC-46749-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-46749-01

Size / count 50 μL

Specifications

Catalog number: KC-46749-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipase A-2-activating protein, PLA2P, PLAP
Gene Name: PLAA
Gene ID: 9373
UniProt: Q9Y263
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLAA
Target: PP-5571
Partner Proteins: Phospholipase A-2-activating protein; PLA2P; PLAP
Clone: K29129_13G1
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTREGQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQML
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PLAP
Target Alternative Name: Phospholipase A2 Activator Protein
Panel Description: Neuroscience Biomarkers, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Phospholipase A2 activating protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Phospholipase A2 Activator Protein Antibody?

The catalog number for Phospholipase A2 Activator Protein Antibody is KC-46749.

What sizes are available for Phospholipase A2 Activator Protein Antibody?

Phospholipase A2 Activator Protein Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Phospholipase A2 Activator Protein Antibody come in?

Phospholipase A2 Activator Protein Antibody is available in 3 different pack sizes.

Is Phospholipase A2 Activator Protein Antibody in stock?

Phospholipase A2 Activator Protein Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

All Products