Phospholipase A2 Activator Protein Antibody

Catalog number KC-46916-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-46916-01

Size / count 50 μL

Specifications

Catalog number: KC-46916-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipase A-2-activating protein, PLA2P, PLAP
Gene Name: PLAA
Gene ID: 9373
UniProt: Q9Y263
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLAA
Target: PP-5571
Partner Proteins: Phospholipase A-2-activating protein; PLA2P; PLAP
Clone: K29129_16D3
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTREGQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQML
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PLAP
Target Alternative Name: Phospholipase A2 Activator Protein
Panel Description: Neuroscience Biomarkers, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Phospholipase A2 activating protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Phospholipase A2 Activator Protein Antibody?

The catalog number for Phospholipase A2 Activator Protein Antibody is KC-46916.

What sizes are available for Phospholipase A2 Activator Protein Antibody?

Phospholipase A2 Activator Protein Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Phospholipase A2 Activator Protein Antibody come in?

Phospholipase A2 Activator Protein Antibody is available in 3 different pack sizes.

Is Phospholipase A2 Activator Protein Antibody in stock?

Phospholipase A2 Activator Protein Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.