Phospholipase A2 Activator Protein Antibody

Catalog number KC-46810-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for KC-46810-01

Size / count 50 μL

Specifications

Catalog number: KC-46810-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Phospholipase A-2-activating protein, PLA2P, PLAP
Gene Name: PLAA
Gene ID: 9373
UniProt: Q9Y263
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human PLAA
Target: PP-5571
Partner Proteins: Phospholipase A-2-activating protein; PLA2P; PLAP
Clone: K29129_19D7
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 95%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: EDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTREGQTRLIRDGEKVEAYQWSVSEGRWIKIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQML
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 95%
Recombinant Antibody: Not recombinant
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: PLAP
Target Alternative Name: Phospholipase A2 Activator Protein
Panel Description: Neuroscience Biomarkers, Ubiquitin-Proteasome System
Host or Source: Mouse
Protein Name: Phospholipase A2 activating protein
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG1

Frequently Asked Questions

What is the catalog number for Phospholipase A2 Activator Protein Antibody?

The catalog number for Phospholipase A2 Activator Protein Antibody is KC-46810.

What sizes are available for Phospholipase A2 Activator Protein Antibody?

Phospholipase A2 Activator Protein Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Phospholipase A2 Activator Protein Antibody come in?

Phospholipase A2 Activator Protein Antibody is available in 3 different pack sizes.

Is Phospholipase A2 Activator Protein Antibody in stock?

Phospholipase A2 Activator Protein Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.