Recombinant S100A13 Antibody

Catalog number RN-14943-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14943-01

Size / count 50 μL

Specifications

Catalog number: RN-14943-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Protein S100-A13, S100 calcium-binding protein A13
Gene Name: S100A13
Gene ID: 6284
UniProt: Q99584
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human S100A13
Target: PP-958
Partner Proteins: Protein S100-A13; S100 calcium-binding protein A13
Clone: K40117_15F5
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 84%, Rat - 40%, Pig - 92%, Cynomolgus monkey - 97%
Purity: ≥85%
Cores: ESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLI
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 84%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: S100A13
Host or Source: Mouse
Protein Name: S100 calcium binding protein A13
WB Description: Succeed
IP description: Fail (MCF-7)
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant S100A13 Antibody?

The catalog number for Recombinant S100A13 Antibody is RN-14943.

What sizes are available for Recombinant S100A13 Antibody?

Recombinant S100A13 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant S100A13 Antibody come in?

Recombinant S100A13 Antibody is available in 3 different pack sizes.

Is Recombinant S100A13 Antibody in stock?

Recombinant S100A13 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.