Recombinant ERH Antibody

Catalog number RN-14820-01

Choose a variant (3 options)

Selecting a variant updates its price, size and availability.

Price for RN-14820-01

Size / count 50 μL

Specifications

Catalog number: RN-14820-01
Size / count: 50 μL
Dry ice: No
Hazardous: No
Discontinued: No
Product Name Alternative: Enhancer of rudimentary homolog
Gene Name: ERH
Gene ID: 2079
UniProt: P84090
Antigen Species: Human
Reactivity: Human
Cross Reactivity: Not tested
Immunogen: Recombinant human ERH
Target: PP-11500
Partner Proteins: Enhancer of rudimentary homolog
Clone: K92112_16E1
Conjugation: Unconjugated
Applications: Top_WB
Validation: Top_WB
Homology: Highest antigen sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%
Purity: ≥85%
Cores: TKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQ
Storage Temperature: Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower
Identity Mouse: 100%
Recombinant Antibody: Yes
WB Dilution: 1:1000
Formulation: Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide
Antibody Type: Monoclonal
Gene Name Synonym: /
Target Alternative Name: ERH
Host or Source: Mouse
Protein Name: ERH mRNA splicing and mitosis factor
WB Description: Succeed
Shipping Temperature: Shipped at ambient temperature or with ice packs.
Isotype: IgG2a

Frequently Asked Questions

What is the catalog number for Recombinant ERH Antibody?

The catalog number for Recombinant ERH Antibody is RN-14820.

What sizes are available for Recombinant ERH Antibody?

Recombinant ERH Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does Recombinant ERH Antibody come in?

Recombinant ERH Antibody is available in 3 different pack sizes.

Is Recombinant ERH Antibody in stock?

Recombinant ERH Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended incubation time for this antibody?

A suggested incubation time is provided in the recommended protocol on the datasheet, but may need adjusting depending on your sample type and detection system.

What should I check when this product first arrives?

Inspect the package immediately for transportation damage, ice loss, leakage, or breakage. Report any issues right away with photos and your order reference; our specialists will determine whether the product is still usable or needs replacing.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.